PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_023323-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family WRKY
Protein Properties Length: 106aa    MW: 12209.7 Da    PI: 9.3998
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_023323-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR121.57.8e-0710762188
           FAR1 21 kskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkek.dgkwevtkleleHnHe 88
                   ++k + e+++  f+  k+gk++ +++   + r+    +  gC+ k +v++++ d+++++t+ e  HnHe
  NNU_023323-RA 10 RTKSELEVIDDGFKWRKYGKKTVKNSP--NPRNYYRCSSGGCNVKKRVERDReDSRYVITTYEGVHNHE 76
                   5567888999999999***99998877..88888889999**********999***************7 PP

2WRKY98.35e-311976259
                   --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
           WRKY  2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59
                   dDg++WrKYG+K+vk+s++pr+YYrC+s gC+vkk+ver++ed ++v++tYeg Hnhe
  NNU_023323-RA 19 DDGFKWRKYGKKTVKNSPNPRNYYRCSSGGCNVKKRVERDREDSRYVITTYEGVHNHE 76
                   8********************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.804.4E-33578IPR003657WRKY domain
SuperFamilySSF1182903.53E-281078IPR003657WRKY domain
PROSITE profilePS5081131.8121378IPR003657WRKY domain
SMARTSM007742.6E-341877IPR003657WRKY domain
PfamPF031061.2E-241976IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 106 aa     Download sequence    Send to blast
MDVGSRVAFR TKSELEVIDD GFKWRKYGKK TVKNSPNPRN YYRCSSGGCN VKKRVERDRE  60
DSRYVITTYE GVHNHESPCV VYYNEMPLMV PSGWTLQASH SHSSSS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2ayd_A2e-27578174WRKY transcription factor 1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010243312.12e-75PREDICTED: probable WRKY transcription factor 51
SwissprotQ93WU93e-43WRK51_ARATH; Probable WRKY transcription factor 51
TrEMBLS5CKE44e-59S5CKE4_JATCU; Uncharacterized protein
STRINGVIT_07s0031g01710.t018e-58(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G64810.13e-44WRKY DNA-binding protein 51